PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8731_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 463aa    MW: 49976.6 Da    PI: 5.3589
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8731_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-165095147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v q+G ++W  Iar ++ gR++k+c++rw + 
    Neem_8731_f_1 50 KGPWSPEEDAVLSRLVSQFGARNWGMIARGIP-GRSGKSCRLRWCNQ 95
                     79******************************.***********985 PP

2Myb_DNA-binding53.26.7e-17102146147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd +++ a++ +G++ W++Iar ++ gRt++ +k++w++ 
    Neem_8731_f_1 102 RKPFTDEEDGIIISAHAVHGNK-WAAIARLLP-GRTDNAIKNHWNST 146
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8434596IPR017930Myb domain
SuperFamilySSF466891.16E-2948143IPR009057Homeodomain-like
SMARTSM007178.1E-144998IPR001005SANT/Myb domain
PfamPF002491.0E-145095IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2551103IPR009057Homeodomain-like
CDDcd001672.50E-135294No hitNo description
PROSITE profilePS5129425.78697151IPR017930Myb domain
SMARTSM007174.5E-15101149IPR001005SANT/Myb domain
PfamPF002492.3E-14102146IPR001005SANT/Myb domain
CDDcd001672.74E-11104147No hitNo description
Gene3DG3DSA:1.10.10.607.7E-24104150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MNDKDDSKNQ NDDVDAAILV EDTSEPGSAG AGVAGGESSK NGGVGGSRVK GPWSPEEDAV  60
LSRLVSQFGA RNWGMIARGI PGRSGKSCRL RWCNQLDPSL KRKPFTDEED GIIISAHAVH  120
GNKWAAIARL LPGRTDNAIK NHWNSTLRRR YSELGRFKPA RGEVIEDGSL DRTKASSEET  180
LSAGDVNSLK PPEGRDVAMD DRTNHYVDVA QTTGGQFAAA LNPHPSFSCT VGDINSFKVP  240
EEREVMIDDR SNVHEDRAQR KEVEFATGPK SHPTLTRPVA RVSAFNLYNS SGGLTPCSGI  300
TGTVPTQGPF VQVAKPDFGI NKFLEDVCSE PVIPSQCGYG CCTSPMERHS HASLLGPEFV  360
DYEETPAFSS HELISIATDL NNIAWIKSGL ESSSIGVPGI AANQRMAQGT AGSSEMEISE  420
QSVRKDMHFE DGRNKLMGMM TDVLPSQVAR QTFAMRAEVE GLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-38491506107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435568.10.0hypothetical protein CICLE_v10031463mg
RefseqXP_006486452.10.0PREDICTED: uncharacterized protein LOC102618168
TrEMBLA0A067G0P20.0A0A067G0P2_CITSI; Uncharacterized protein
STRINGGLYMA14G06870.21e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-108myb domain protein 109